PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000206202
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GRAS
Protein Properties Length: 317aa    MW: 35866.3 Da    PI: 5.9606
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000206202genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS28.81.5e-09258311255
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55 
                     + Ll++Ae v  +++e+a++lL + +  as + + +qR+++yfteAL++r+ +
  MDP0000206202 258 AHILLAAAEKVGYQQFERANRLLLHCEVDASFKVNGVQRVVFYFTEALRERIKQ 311
                    699*************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035145.0E-7258311IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MHSSPSQPLI FGVLGSGGGL TPQLEEYEKE DQEFKGKPDH LVGIQELGLG ERENLSHLSK  60
DQQHFKASYL MTDNFSFDTV CSEHDLQRSN SKSKKGRAHA KITPRQYQQQ NQHYQQQSKS  120
NYFDLDNFXF DPSFPSTQTI QDAGNQLMYS QIGGSDIAET NKQMPHQSSL AALDLLNNYG  180
SAFKKLRGDR LSNRCNEAEA SSYSIQQKLS TEEIMRVAGA RYVQISDQGY GDFFMPLHPF  240
GYXLSGLSEE ETKDVELAHI LLAAAEKVGY QQFERANRLL LHCEVDASFK VNGVQRVVFY  300
FTEALRERIK QETGNSM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374972.10.0PREDICTED: uncharacterized protein LOC103438223
TrEMBLM5VUD51e-125M5VUD5_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162